Scaffold Ga0074020_10043946

Overview

Basic Information

• Taxon OID: 3300030840
• Scaffold ID: Ga0074020_10043946
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 892
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Sweden: Dalarna County
• Coordinates
  • Lat. (^o): 60.97
  • Long. (^o): 15.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049459	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074020_100439462	F049459	AGGAG	MKKVLFTAALSAAAFVGLSGVGLRAQELTDQEVRPAVGVFDKFLRPDGPECVPVSEIGSVSRLTKLTPAQFQFVRALYIAIPPVSRQLPPGDSAVMASADGKAMIALVTQGGVACARFLAPDFILTMLAQVARGETGSSGQPI