Basic Information | |
---|---|
Taxon OID | 3300030839 Open in IMG/M |
Scaffold ID | Ga0073999_10015945 Open in IMG/M |
Source Dataset Name | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 788 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Montana | |||||||
Coordinates | Lat. (o) | 46.9233 | Long. (o) | -110.871944 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070716 | Metagenome / Metatranscriptome | 122 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073999_100159451 | F070716 | N/A | GVWNSLHLDKRLRVNAIKIAMMLPFPFQTLVSPLDFVSITVTAQQFATIKEEKDLNVRVPPPTKTVTRSTPTFRTIPPPTETPRALVKIEPRIEAHIPDEFQGLNVVTADVVVAEVVNFCDFGNCFGDLTVATPSFKLPSSKSPIMEAMVYCAIHKWGIELEHHDKAAQQIVFKVLDFEHYYRLSCVICSKQTPSEDIRSRMKALQRWFTSFPSRKDLRQSFSLTVKVRQFRKVHDIIEKVKKFVQEFSPDR |
⦗Top⦘ |