NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315872_119420

Scaffold Ga0315872_119420


Overview

Basic Information
Taxon OID3300030820 Open in IMG/M
Scaffold IDGa0315872_119420 Open in IMG/M
Source Dataset NameMetatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T28 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)597
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.7417Long. (o)-117.7042Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039430Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0315872_1194201F039430GGALSLDSVSFSGSDGESLGGDSLASLVSLSLLLIVISASLEESFSGGRDSDVVGSDVDSLGDDSVSELLVYDNTDGSGVDVEHSTGLSVVKVVGHALMDGTINNDVDVITDSIAGEDVGDTDGSVLSEALGELGSSSCSKTV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.