Scaffold Ga0265746_1019741

Overview

Basic Information

• Taxon OID: 3300030815
• Scaffold ID: Ga0265746_1019741
• Source Dataset Name: Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 813
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9982
  • Long. (^o): 10.7894

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019696	Metagenome / Metatranscriptome	228	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265746_10197412	F019696	GAG	MGAETARFQAFATRRDDDLPPPWQMKAPGSKIGMLVAIVIVVAILALLLGVILGA