| Basic Information | |
|---|---|
| Taxon OID | 3300030809 Open in IMG/M |
| Scaffold ID | Ga0265793_109458 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T4 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 645 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 33.7416 | Long. (o) | -117.7042 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041531 | Metatranscriptome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265793_1094582 | F041531 | N/A | DAYQRCRIGRRWGFLPSQLGHTTYPAYKRERGLRVRRAWTPLPEPSDDVEFPEELVRITGRDPTPVEAEALRVVMWTHGRWGGSKRDVFSPSCGKVRRSYRYRAQPCWSSLSFVGSGRPKLSPLREKGGEMSLVPASFISDEESKGIADLEQFRRNWDRGFIISDLEALDRDR |
| ⦗Top⦘ |