NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0061016_10022307

Scaffold Ga0061016_10022307


Overview

Basic Information
Taxon OID3300030771 Open in IMG/M
Scaffold IDGa0061016_10022307 Open in IMG/M
Source Dataset NameCoassembly of Cow Y Switchgrass
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)760
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location NameUSA: Illinois
CoordinatesLat. (o)40.102108Long. (o)-88.227299Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028061Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
Ga0061016_100223072F028061N/AIMGAKNSVAKILTPPKKKEDYMNMFPLDRDLKVYNAATAEFEQITSKKKTMTKDQFMKSQASRFAGMDPHLLGAIWNAFDADGNGVMDVNEFRLYHAVNAVGSNNQRAMALFAVTDTSNDRVLQQSEIVSMMILARKFKKRAAMDAPPTGAIDLTADEVLQVTKDADAFMERHDKDKSKSVEIDEFMKGWQDQAFADFNFFDSKVLPEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.