NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308136_1044572

Scaffold Ga0308136_1044572


Overview

Basic Information
Taxon OID3300030728 Open in IMG/M
Scaffold IDGa0308136_1044572 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1026
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)75.0007Long. (o)-150.0027Alt. (m)Depth (m)146
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042625Metagenome / Metatranscriptome158Y
F098044Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0308136_10445721F098044N/AIKTDNAQAVLGVNTTYDTMLSIEALILANPMMSELRTIGKLNKTSLMKMALMEFLKTPVSSRRLKKLFIASNSDDKFRAIIQGGKLD
Ga0308136_10445723F042625AGGAGGMTDKSEKDSLWKDLKLQWSYLKRDSGADEVKKGAAKERINEIQEALKLDKTDWNQPRSGPPGSHLTNAGASSNPSDKILIEKVLGTVLDMKRVMNEEFMAITQKINSLDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.