| Basic Information | |
|---|---|
| Taxon OID | 3300030727 Open in IMG/M |
| Scaffold ID | Ga0308140_1023367 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_532_33.10 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 988 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Western Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 77.9995 | Long. (o) | -150.0065 | Alt. (m) | Depth (m) | 200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012639 | Metagenome / Metatranscriptome | 279 | Y |
| F015413 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0308140_10233671 | F012639 | AGGGGG | MSSNNSGLVLNCTAAYAANAPIATVSPCLMQTSPVVAGVNELQVPLTENWIATDVYILATGNAAGNPTAVDPVISMDKNRGRQLVQTPPLSAMLITSNTRPRFSPQPIGFEGGSIVRMFATSTVLNAGALSNV |
| Ga0308140_10233672 | F015413 | GGA | MESTDLEKQVETLLATPQFEQPEFDQSISSTVKDIFSKSMLVSSAGTALSVQLGNVVGKYIPMGIAPTGAGAIVAGVLLSKFGGSNRMLKDLGLGVIQGGIAQAMTPFVSGLIPAQFSQEVKTEKVAEELNPMVKGVMW |
| ⦗Top⦘ |