Scaffold Ga0308128_1011088

Overview

Basic Information

• Taxon OID: 3300030725
• Scaffold ID: Ga0308128_1011088
• Source Dataset Name: Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1048
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 70.5467
  • Long. (^o): -122.9077
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099359	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308128_10110881	F099359	AGGA	LDINGNVDAENRNIEIYPKHGRINQQWDLLYTDEYKGEPVKGELNERFGLYVERPFYIVSQLASHRYLDLIDNRNMVIKTRNGRNTQEWYFHQQSLTIRSK