Scaffold Ga0307921_1000739

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307921_1000739

Scaffold Ga0307921_1000739

Overview

Basic Information
Taxon OID	3300030712 Open in IMG/M
Scaffold ID	Ga0307921_1000739 Open in IMG/M
Source Dataset Name	Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-3 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3343
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (77.78%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location Name	Finland: Risofladan, Vaasa
Coordinates	Lat. (^o)	63.0472	Long. (^o)	21.7116	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022597	Metagenome / Metatranscriptome	213	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307921_10007392	F022597	AGGAG	MAKHNVSLYRALHHLRKGGLHRALNVAEGTPIPAAKLAAAKNSKSEHVRKMANFAATMSHFHHAKKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.