Scaffold Ga0187749_185362

Overview

Basic Information

• Taxon OID: 3300030678
• Scaffold ID: Ga0187749_185362
• Source Dataset Name: Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium under control temperature from Pennsylvania, USA - 25_T2E_2612KB8 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 40.7982
  • Long. (^o): -77.8599
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086596	Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187749_1853621	F086596	N/A	SDTGRPVDLRLRIFLASEVMTRILSSLMLPFLVAGHSRSLRGDGDVYVDSVKCTGDKPLPMEPACFSGGMLVETFNIQVLSYNGQIGTVNLQAEGSQSAQCDGAEFVNQDNVITIANDKGCGLSDYDYNVRYCPDQDSLIVNLVKPFNVRVVLNSKTCPAGEV