Scaffold Ga0307401_10211793

Overview

Basic Information

• Taxon OID: 3300030670
• Scaffold ID: Ga0307401_10211793
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 875
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -66.0031
  • Long. (^o): -12.2867
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007790	Metagenome / Metatranscriptome	344	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307401_102117931	F007790	N/A	MMQALQAADNMFADGRDDAQSAVMVISDGKWTNAYRTTMKATAMKDKGIQIFMAPIAEHMNANLQILRGWASEPWETNFELIPGLKSLVNNEPEFAQKLLVKFCPRAFSPSLKEEQETQTGYLKIHEEGYPTDSCASWAHLGIYDSADACMEAVKAKDGLAFAFLEGGRSGGTCYLEGIDVTSEVWAGAMNDRVNMTCPGTEGGWQYNEYASTYIMNPTMFGALFEDDD