| Basic Information | |
|---|---|
| Taxon OID | 3300030663 Open in IMG/M |
| Scaffold ID | Ga0187761_1023974 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium under thermal stress from Pennsylvania, USA - 37_T2E_3212EL1 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 724 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania | |||||||
| Coordinates | Lat. (o) | 40.7982 | Long. (o) | -77.8599 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002609 | Metagenome / Metatranscriptome | 543 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187761_10239741 | F002609 | N/A | QQWAGPWGSNWYKYLLTVPFIPVIHFFGLNDTGSLFALEWWMHFPDEGAGGKCNKEFWSKWVPRRIKHNAFVLGLWTCVWLLGTYPLGRPLSEGWRFMFAVSFFARVGYSAAWMFITNFTHSLPWNEFLAQDPGRTWPVLHNIMAMVLGGKHRWNEMLFHDVHHAFPNAVGTLSQRGRFHGWEKVHDAAAEVLHRGLWKPNGDEETQMQKTQKKRSLMMKQGK |
| ⦗Top⦘ |