NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187735_139686

Scaffold Ga0187735_139686


Overview

Basic Information
Taxon OID3300030662 Open in IMG/M
Scaffold IDGa0187735_139686 Open in IMG/M
Source Dataset NameMetatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 10_T1E_StrKB8 developmental time series (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)687
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)40.7982Long. (o)-77.8599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060930Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0187735_1396861F060930N/AKNAQMATNQKSPGSITSVHPSWKPFGPGFGIHVFRNVIATAGLRMFCSPCRTAIEKATGNSNSMTTLAGDFAGNVCAACLSAPVHQLYGYTVTTPELRTLPAAEQRERMVSFLKNQYLDTSNGRTRLSGLVPRDLFMRSMYVAVAYTMYSTVERTLVANWPQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.