NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210268_1153532

Scaffold Ga0210268_1153532


Overview

Basic Information
Taxon OID3300030629 Open in IMG/M
Scaffold IDGa0210268_1153532 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)697
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameCanada: Quebec
CoordinatesLat. (o)47.321Long. (o)-71.0886Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074197Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0210268_11535321F074197N/ALIMATQKVNMKLLEAIIVGKSKQASNLTLFEKLHTSTGKKHAHRWFKHRCDSARCLEEGKLLNLLRALTKRNDHEIFDLIDIFDEDYEGSLSWSRFYMIIALFSALGGRETVKFLYKHGEEMFKILTAHGPAQLDFSKFATFGWLLGISEEDLVQSIATNFHIGTDRLREQTINAEDFITFYFPTLQSLDEFGTVRQYTTQDLIKNSPFFACVIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.