NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268386_10491574

Scaffold Ga0268386_10491574


Overview

Basic Information
Taxon OID3300030619 Open in IMG/M
Scaffold IDGa0268386_10491574 Open in IMG/M
Source Dataset NameSoil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)842
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)42.9888Long. (o)-108.3994Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003507Metagenome / Metatranscriptome482Y
F018428Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0268386_104915741F018428N/AMRRFGRQCRGQGQVFVSLVRQTETQLLATGQPVVGLARAAQEYVQGAAHLTEDQQGRLATQLTGALAAHHQIVTQSRRLTNGKTLTQCKIVNAYDPTIAPICKGKSNCPTQFGRKPGIIAEPATGFIFALHLPVGNPSDPSYVVPLVDKVQHALGQVA
Ga0268386_104915742F003507N/ARTDLAVMYACGIREVRVERSQAHFVLPEVLAQFRSRLDAALMDELLALQAAAAMEQGLVSPAHLVVDTFPSEQGSQRVNDAATLYKAKKKPSRSSPTSLTSALPRARR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.