| Basic Information | |
|---|---|
| Taxon OID | 3300030615 Open in IMG/M |
| Scaffold ID | Ga0257185_10314717 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 569 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 45.7544 | Long. (o) | -113.9092 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024232 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257185_103147171 | F024232 | N/A | LGMNDPRVGLDPEKMNEPPNLQSKPPASRRNSWDPDMGDSVSGVAGATGHPRSRSGSWDFGLAKMFSMGRHFPEDVATDPPGIHKQRGSIGAGLPMPSEQPAPVRRNSFVTQMFSQGRFFPEDAAGGLHRDK |
| ⦗Top⦘ |