Basic Information | |
---|---|
Taxon OID | 3300030612 Open in IMG/M |
Scaffold ID | Ga0257196_1332531 Open in IMG/M |
Source Dataset Name | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 549 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Montana | |||||||
Coordinates | Lat. (o) | 46.9233 | Long. (o) | -110.8694 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078136 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257196_13325311 | F078136 | N/A | ADIRDEGNATSQLLARTCTLHRLVPRQSLASVSEVCPAVGTDPICRQIPDTTAIITTNLIDTTNSILSDSTTILSEKTLINSADNNHLTQPIHTPQQELDAIRGKSSIEQVDVDRKNDGKSITFSIFLMITALFLCSN |
⦗Top⦘ |