| Basic Information | |
|---|---|
| Taxon OID | 3300030593 Open in IMG/M |
| Scaffold ID | Ga0210263_1060720 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 752 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Quebec | |||||||
| Coordinates | Lat. (o) | 47.2713 | Long. (o) | -71.2091 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024009 | Metagenome / Metatranscriptome | 207 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210263_10607201 | F024009 | N/A | FGFYASDFRVSIVNSIIKAFSVFKNLFRKVKLSVPIPTHKMKIIICLLLLSLIALVIAQEPKKPMWPDAFSATVVRRTNNGMHFSRWFYDFKNLRDRFDGFAEWHGEFYFAEQIFKHTEGFDYTIYYRDSEVTCTKNKINSTMIKPDFSNFRFAGISLVNYQQCYKWVANDTRRDFFQFWDRVSDREPVRFDVINRFRQEEQFTFTEFDVGAQDQSLFDVPPIIKDSCFTPGKKF |
| ⦗Top⦘ |