Scaffold Ga0210275_10359696

Overview

Basic Information

• Taxon OID: 3300030578
• Scaffold ID: Ga0210275_10359696
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 524
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Canada: Quebec
• Coordinates
  • Lat. (^o): 47.3029
  • Long. (^o): -71.1332

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042661	Metagenome / Metatranscriptome	157	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0210275_103596961	F042661	N/A	DFILEYRGNCARSNFGQKGECELRAQSEEFITSISGDGKVHLQVIGLIGSISKFRLTDSLYANNSYSAKGNVTFGVHQNHEQHKIYFETLGAGRQTAVPDPTKEFGFAGVLGITGGDGALKGAYGSITINGVALVGDGEVILVAAGVVWLKKA