Scaffold Ga0247648_1069686

Overview

Basic Information

• Taxon OID: 3300030574
• Scaffold ID: Ga0247648_1069686
• Source Dataset Name: Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 722
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: France: Rollainville
• Coordinates
  • Lat. (^o): 48.3625
  • Long. (^o): 5.7397

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098326	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247648_10696862	F098326	GAG	MRVVNWGRRGGVEHLFPAALLLRLDDLLHDLGLLHQERPKDPRLYTVSTPRTTVSPPHSLPRLGDSSILAWSQSRNSGESNTTVTTLGSSGKFSDVVVDELSSWCLYDTASVGGSVVWLAFAECNTLSHCALDDRASETIW