NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257207_1033039

Scaffold Ga0257207_1033039


Overview

Basic Information
Taxon OID3300030562 Open in IMG/M
Scaffold IDGa0257207_1033039 Open in IMG/M
Source Dataset NameMetatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-2W (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)707
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States

Source Dataset Sampling Location
Location NameUSA: Montana
CoordinatesLat. (o)46.9239Long. (o)-110.8719Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y

Sequences

Protein IDFamilyRBSSequence
Ga0257207_10330391F005470N/AKKEGQLITEFPAEMIPRSRLLNKLKEEFNSTEVELEPAPGKDFSPATINKVKEFLQKFDKGLHKMPKKPLLIFVTYNDWLDNNFEEKIREWLEEFLKPKSFYELVELFNAAFYLQIDDLREITAARIAHSIILERKAPEDFLRDFGIATVYQDFFTPEEEAKFIDKEFINKNDFEGVAAEEDEELNKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.