| Basic Information | |
|---|---|
| Taxon OID | 3300030524 Open in IMG/M |
| Scaffold ID | Ga0311357_10090484 Open in IMG/M |
| Source Dataset Name | II_Palsa_N3 coassembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3073 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Abisko, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3535 | Long. (o) | 19.0473 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001946 | Metagenome / Metatranscriptome | 613 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311357_100904844 | F001946 | N/A | QDRNMGSVPADPADARPREWLALPGGGIRPVVSVPGNGGVAELLAYAAWLARLRPACRCGRPRLGSGRTCGSAECVAELRVQETGG |
| ⦗Top⦘ |