 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300030523 Open in IMG/M |
| Scaffold ID | Ga0272436_1142944 Open in IMG/M |
| Source Dataset Name | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 726 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Victoria Land | |||||||
| Coordinates | Lat. (o) | -75.9 | Long. (o) | 159.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002432 | Metagenome | 559 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272436_11429441 | F002432 | N/A | DVERELRIYCNYMQNDXAKXISMMKFSDNFNIFSITSMTLFYFNKEFHLRMSFNSDTTDYETTCERLEARKTDDIVIXMKELLSFDRQQLKKTKLIIEVQINKHKRDVTYEVDDXVXLSFRNVKTTRLCKDLKNRQLDLYQITAKVSTFYHLHLSVSMKHLHSMFSSKLLRSYSEDSLSKQHSESLRSITIKDDKHXKINDILNFRRYRDRIQYKVKXKDLDRNDEXYYVDKEKFDDSEKVL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |