Scaffold Ga0272436_1007989

Overview

Basic Information

• Taxon OID: 3300030523
• Scaffold ID: Ga0272436_1007989
• Source Dataset Name: Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10640
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Victoria Land
• Coordinates
  • Lat. (^o): -75.9
  • Long. (^o): 159.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068293	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0272436_10079891	F068293	N/A	LGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASHIELSSHTNCSAKQGLVLDTDF