Scaffold Ga0311372_12453163

Overview

Basic Information

• Taxon OID: 3300030520
• Scaffold ID: Ga0311372_12453163
• Source Dataset Name: III_Palsa_N2 coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 588
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Abisko, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3535
  • Long. (^o): 19.0473
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008041	Metagenome / Metatranscriptome	340	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311372_124531631	F008041	N/A	FICPYGTPVLKVRFALRRLLRAGYHVVAYQTTPAVFTDGDPLILPELITQVRDDVRRRVAELTAAGVTEFGFFGSSLGSFILYNCVGDEIPAFRWGVFNTGGNIARGLWRMPDLRQAHEARGWSLPRLEEAWAELQWPAFGRLDGCRFVFSSSRRDSIAPLGDIAQYLGPMLQAGAQVRVCEVPALSHRTTVIAGL