| Basic Information | |
|---|---|
| Taxon OID | 3300030517 Open in IMG/M |
| Scaffold ID | Ga0272420_1010528 Open in IMG/M |
| Source Dataset Name | Rock endolithic microbial communities from Victoria Land, Antarctica - Battleship Promontory nord |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6614 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Victoria Land | |||||||
| Coordinates | Lat. (o) | -76.9 | Long. (o) | 160.9 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009446 | Metagenome | 317 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272420_10105285 | F009446 | AGG | MPTAIRAVVRQLGGGEERAQIVAGTRTLASELGVAVRTMQRWRKEGGEARRVARSTLGLRISVQGIATAQQRQANARAFREQVMEQGLDVGACRVLVLVYNEDRARPRNVGPQHIDGANAGLIDALDALEDGDTAAAAEAFGTAWLGTYGLDVDAEVTDVVGTFALGA |
| ⦗Top⦘ |