Scaffold Ga0268242_1066183

Overview

Basic Information

• Taxon OID: 3300030513
• Scaffold ID: Ga0268242_1066183
• Source Dataset Name: Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 705
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Mexico: San Luis Potosi
• Coordinates
  • Lat. (^o): 21.766
  • Long. (^o): -100.163

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083219	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0268242_10661831	F083219	N/A	AQVASASPRQRCKLKILQRTIRRKRGKHCARIRFEDDNGKIHEIMRTADNKSAAKTRLAQLEAEILEKGTARFEAGKVTFRQLAEYVKTRFYVPATYSEDGSKISGVRSVQPAHSSIKKLVEYFGDKDITKIDDEALEKYKARRLKTVSIATVDRELCKARKMFGVALSKKWVFDHPFKTEAGKQLIQVAAEKGAVEHVLSDAEEQRLFKALQTADRRHTIPVFIAALETGARWS