Scaffold Ga0268241_10178808

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268241_10178808

Scaffold Ga0268241_10178808

Overview

Basic Information
Taxon OID	3300030511 Open in IMG/M
Scaffold ID	Ga0268241_10178808 Open in IMG/M
Source Dataset Name	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	531
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Mexico: Amatitan, Jalisco
Coordinates	Lat. (^o)	21.053	Long. (^o)	-103.902	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079736	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268241_101788082	F079736	AGGAG	MPVVVNEVEVVPAERAAEKAEQSQGGGGEQTPPSEHEIRRMVEHQMSRCERVWAY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.