Scaffold Ga0268243_1073016

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268243_1073016

Scaffold Ga0268243_1073016

Overview

Basic Information
Taxon OID	3300030510 Open in IMG/M
Scaffold ID	Ga0268243_1073016 Open in IMG/M
Source Dataset Name	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	770
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Mexico: Magueyal, Guanajuato
Coordinates	Lat. (^o)	21.195	Long. (^o)	-100.439	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042558	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268243_10730161	F042558	N/A	MARTNGRGPGLFDEQIVYAALDAIDQTLEQALTARTEMQQRWLLNQLRGLLLTLPSSGLSLEDSLRQLIRLLRTPMVDR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.