Scaffold Ga0268258_10033373

Overview

Basic Information

• Taxon OID: 3300030502
• Scaffold ID: Ga0268258_10033373
• Source Dataset Name: Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 956
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Guanajuato, Mexico
• Coordinates
  • Lat. (^o): 21.7658
  • Long. (^o): -100.163

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001316	Metagenome / Metatranscriptome	724	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268258_100333732	F001316	AGG	VKALLLIVGILVATAGGVITYRALYLEPTSAVIITESEVRQLPNYARVIGGALLFVGGSALALYAAVRKVR