| Basic Information | |
|---|---|
| Taxon OID | 3300030499 Open in IMG/M |
| Scaffold ID | Ga0268259_10036060 Open in IMG/M |
| Source Dataset Name | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 969 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guanajuato, Mexico | |||||||
| Coordinates | Lat. (o) | 21.0936 | Long. (o) | -100.2988 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076212 | Metagenome / Metatranscriptome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268259_100360602 | F076212 | N/A | MFIVTARTPKDALTPEKAWTFYFTEAGGRIYALTTDVPVEFSERMTLEAERFIESLRNRE |
| ⦗Top⦘ |