Scaffold Ga0310040_1000551

Overview

Basic Information

• Taxon OID: 3300030493
• Scaffold ID: Ga0310040_1000551
• Source Dataset Name: Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 33823
• Total Scaffold Genes: 33
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 27 (81.82%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location

• Location Name: Espanola, New Mexico, United States
• Coordinates
  • Lat. (^o): 35.9918
  • Long. (^o): -106.0796

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106197	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310040_100055112	F106197	GAG	VADVKSALACFLLLLLVTGTESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWTIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG