Basic Information | |
---|---|
Taxon OID | 3300029959 Open in IMG/M |
Scaffold ID | Ga0272380_10233727 Open in IMG/M |
Source Dataset Name | EPA Superfund site combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1318 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Espanola, New Mexico, United States | |||||||
Coordinates | Lat. (o) | 35.992 | Long. (o) | -106.0797 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056711 | Metagenome / Metatranscriptome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0272380_102337271 | F056711 | GAGG | MRKAFTVLAAAAFALSIVAGGCAKDKSPSQIQPAKKGIAGTEKKAAPKPRAKLFTGTIEDLDEAAGTLTLKGPKGEMSFQARKKVKEQLCELEIGDKVIVKHDGKTALSIVKPRTSKTALAWHRNEETKTVREEFH |
⦗Top⦘ |