NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272380_10039138

Scaffold Ga0272380_10039138


Overview

Basic Information
Taxon OID3300029959 Open in IMG/M
Scaffold IDGa0272380_10039138 Open in IMG/M
Source Dataset NameEPA Superfund site combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4404
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Metamonada → Parabasalia → Tritrichomonadida → Tritrichomonadidae → Tritrichomonas → Tritrichomonas foetus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location
Location NameEspanola, New Mexico, United States
CoordinatesLat. (o)35.992Long. (o)-106.0797Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049012Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0272380_100391381F049012GAGVAFFLLMPEVVFQCQNRTKHVEKGVLSCLKRFRDEYSTKDRIVLSDSCDFDVFCHFIDFLVSGDIPSDRNDQIGVINLLREWESHFGIVDSFRFRLCCQEKDGIVVYNGDKYEVNIGCLLFHSEVFREFYQNSCGMVFNFDSSYS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.