| Basic Information | |
|---|---|
| Taxon OID | 3300029959 Open in IMG/M |
| Scaffold ID | Ga0272380_10010353 Open in IMG/M |
| Source Dataset Name | EPA Superfund site combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12517 |
| Total Scaffold Genes | 26 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 24 (92.31%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Espanola, New Mexico, United States | |||||||
| Coordinates | Lat. (o) | 35.992 | Long. (o) | -106.0797 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038519 | Metagenome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272380_1001035325 | F038519 | GAG | MYGISTDLGDDWAGPYVDQELLQKTLAIIQQVDPNAEIVSKETDPFSEQVLAGLLPFRIHVDLVDGMPQLPAEVSITWPPGEMEGIRVGNLEYREYFVWAESEKAALRKLATLNKAVQSYSPKAAAAQEL |
| ⦗Top⦘ |