Scaffold Ga0311331_11085721

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0311331_11085721

Scaffold Ga0311331_11085721

Overview

Basic Information
Taxon OID	3300029954 Open in IMG/M
Scaffold ID	Ga0311331_11085721 Open in IMG/M
Source Dataset Name	I_Bog_N3 coassembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	686
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium Tous-C9LFEB	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Abisko, Stordalen Mire
Coordinates	Lat. (^o)	68.3532	Long. (^o)	19.0477	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034040	Metagenome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311331_110857212	F034040	GAG	MNPTTETEAPYTDPEALLQARILKILKPCLSYWLDEQTLYLTLNLSRPAVTRARIETALRELRDKAYLDFRVDPLSRLTEWRLTPSGHALAQPL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.