 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300029943 Open in IMG/M |
| Scaffold ID | Ga0311340_10059778 Open in IMG/M |
| Source Dataset Name | I_Palsa_N3 coassembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4435 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (70.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Abisko, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3535 | Long. (o) | 19.0473 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069068 | Metagenome | 124 | Y |
| F089494 | Metagenome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311340_1005977810 | F069068 | AGGAG | MAHTRLITLNGSAAAFVAVSATQVTRRVEIIEDGSANGGTGQGLAYQFNDGSTTPFTTTYTIEPQSEPIVLGTPVPQGAGFASVVGTPPDNSGGYAIAATLLINLRSAST |
| Ga0311340_100597782 | F089494 | AGGA | MAPNAKPSGSAAIQTQILGQLTEVKSKVEESLQQGRENGNELKMLRRELGLDGQHGRLPIMEALLVRHEARMEKSDERVDKLEADTNEAKGKAKLVATSLALLGGGAGGAMIAFLAHLLGVH |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |