| Basic Information | |
|---|---|
| Taxon OID | 3300029942 Open in IMG/M |
| Scaffold ID | Ga0168096_1011520 Open in IMG/M |
| Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP8 - Uppsala-digested 109 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gothenburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2605 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104571 | Metagenome / Metatranscriptome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168096_10115202 | F104571 | GGTGG | MIDTLKVFTDDFKISDNAGLFVQPATVNYETGETKEYNLFRKDNGAWVTGAKAYVNTGDYQLTIKPIVGNGNGKVLLFLQTSLPKIIHGENYQALNNDETVQAIDAIADDLNNRGVGVNLQACKISRIDVFRMASANNPFSSYAPVFRLLNAKRSHTTDYGTTFTWANTQREICVYDKAVEMRNRGVKSSALPTNAIRFEYRLKTSRVCKKETGAGNVRELVNNLDNLQYVYRQALENSIFSVDAKALATVTASELENGLRVYFKRYGVAFVNRFLRDFGAYALGRLTGVETVKSVLSSVLDDRYKLWRHSKLFDEYRMNFEMARGDLGDSTLKDLYLELKEKILPDNRCETGDLMTV |
| ⦗Top⦘ |