Scaffold Ga0119933_1028631

Overview

Basic Information

• Taxon OID: 3300029932
• Scaffold ID: Ga0119933_1028631
• Source Dataset Name: Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hong Kong
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 728
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002009	Metagenome / Metatranscriptome	604	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119933_10286312	F002009	AGG	MGLVEEVQSARNEVMNPPTIEDMGKAAEEIVWRVMGKGSDKSRYGEWFLVDRPVHDYHIARAIRHLATAMMQLHKSTPCPDGNGETATDHLERAVVRALFVWAQVKKEVPRL