Basic Information | |
---|---|
Taxon OID | 3300029932 Open in IMG/M |
Scaffold ID | Ga0119933_1020805 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hong Kong |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 897 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004208 | Metagenome / Metatranscriptome | 448 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119933_10208052 | F004208 | AGG | MTYSLNSEAKAFSYTREELFECITKIVAHPHKTITEHDQSRALAIMVVFDDYFSNYTESDNNGGYCVYERDATDLTDFVRFKLCIDDYDAVDVNEVLK |
⦗Top⦘ |