Basic Information | |
---|---|
Taxon OID | 3300029932 Open in IMG/M |
Scaffold ID | Ga0119933_1010210 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hong Kong |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1423 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073483 | Metagenome / Metatranscriptome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119933_10102104 | F073483 | AGAAG | MTVEAKDLKLLKSDYTHRIKSVGDRVRGLERRLDWVEKLLWLSAGAVISWLVSIVLRNV |
⦗Top⦘ |