Scaffold Ga0119933_1001639

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119933_1001639

Scaffold Ga0119933_1001639

Overview

Basic Information
Taxon OID	3300029932 Open in IMG/M
Scaffold ID	Ga0119933_1001639 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hong Kong
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3950
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022190	Metagenome / Metatranscriptome	215	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119933_10016393	F022190	GGAGG	MSRVLSIDELRFEDDGLLVVDAVVDDAVVVRPQTHLDPQEWGPALCRGSLYLSDEDLIPATDAELCRLLSERVDDWAPIDTSDWDD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.