Scaffold Ga0119944_1012260

Overview

Basic Information

• Taxon OID: 3300029930
• Scaffold ID: Ga0119944_1012260
• Source Dataset Name: Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hong Kong
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1259
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment Plant In Pearl River Delta Area, China

Source Dataset Sampling Location

• Location Name: China: Pearl River Delta area
• Coordinates
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048282	Metagenome / Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119944_10122602	F048282	AGGGGG	VTTAVKNYVDRCAKILGLGHWEIKLSEQNPPEDAWADIEVSQNLYQATIRFSPDLWKEKATDIRRVVAHELIHCHYAGVERLVDTLEKPLGTAAFEIVSTVWDVESERAADSLSTVVAELLPMPTFGER