| Basic Information | |
|---|---|
| Taxon OID | 3300029930 Open in IMG/M |
| Scaffold ID | Ga0119944_1011126 Open in IMG/M |
| Source Dataset Name | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hong Kong |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1339 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment Plant In Pearl River Delta Area, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Pearl River Delta area | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .5 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066602 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119944_10111262 | F066602 | N/A | VDQNAKLQTADQTLKGAIIALVSYVAYKKGWDMQLVALSIPVLSGVLAYVSTLVGNRKTACLFVPKDENK |
| ⦗Top⦘ |