NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247051_1005920

Scaffold Ga0247051_1005920


Overview

Basic Information
Taxon OID3300029901 Open in IMG/M
Scaffold IDGa0247051_1005920 Open in IMG/M
Source Dataset NameCryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDMAC, Technical University of Denmark
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5660
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location NameGreenland: Kangerlussuaq
CoordinatesLat. (o)67.09Long. (o)-50.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073683Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0247051_10059203F073683AGAAGMSKGEKAESERACLSRLQEMDEALAQMELELPEEMRPLGALARKRVHAWLHRIAAGGADLAQLSEAMAEISGLMDALTARLLLVPWDGHPSRGSLKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.