| Basic Information | |
|---|---|
| Taxon OID | 3300029901 Open in IMG/M |
| Scaffold ID | Ga0247051_1002148 Open in IMG/M |
| Source Dataset Name | Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DMAC, Technical University of Denmark |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9060 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Greenland: Kangerlussuaq | |||||||
| Coordinates | Lat. (o) | 67.09 | Long. (o) | -50.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009324 | Metagenome / Metatranscriptome | 319 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247051_10021485 | F009324 | GGAG | MEAENDSSLTCGQCRKSNNFTSPVSVILLFAPGLSKPYPLIPAEDYRVCSSCDAIFTLVNRAAEAHPQTRQAGPWSRAIVVFSDGHGVDVKAKRGQQQVAMA |
| ⦗Top⦘ |