NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247051_1000377

Scaffold Ga0247051_1000377


Overview

Basic Information
Taxon OID3300029901 Open in IMG/M
Scaffold IDGa0247051_1000377 Open in IMG/M
Source Dataset NameCryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDMAC, Technical University of Denmark
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17835
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (80.95%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location NameGreenland: Kangerlussuaq
CoordinatesLat. (o)67.09Long. (o)-50.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000386Metagenome / Metatranscriptome1203Y
F000407Metagenome / Metatranscriptome1172Y

Sequences

Protein IDFamilyRBSSequence
Ga0247051_100037718F000407N/AMSLKLSLVFSMTLVVLGGCASSGYAVRAVPRIVAETVGKSVNRLQEAFGDPRKVDTTPTRQVYVWFLPATPPGAPVGLHGCEMEVTVEPHSQQVLGYSMTSIGWSKCGEVERRIRII
Ga0247051_10003777F000386N/AMNESGTPELALHVPPDEMVKYIQDLMRLPHDEIAAATALSLAHRQWGGDTPLARAALLRWGALNLAFQDKRLETWTVTRERDKIQVPAALVAAAGVAPLIMTGERAVFDIPALLDATLEFQPAAGQA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.