| Basic Information | |
|---|---|
| Taxon OID | 3300029894 Open in IMG/M |
| Scaffold ID | Ga0247028_1068851 Open in IMG/M |
| Source Dataset Name | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DMAC, Technical University of Denmark |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 756 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Greenland: Tasiilaq | |||||||
| Coordinates | Lat. (o) | 65.38 | Long. (o) | -38.53 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073168 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247028_10688511 | F073168 | GAG | MKKTYQIESLRAVKRLEETAAAGNPSVQMLLLQVR |
| ⦗Top⦘ |