Scaffold Ga0246235_100536

Overview

Basic Information

• Taxon OID: 3300029892
• Scaffold ID: Ga0246235_100536
• Source Dataset Name: Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2011_MF
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Princeton University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 25086
• Total Scaffold Genes: 32
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 20 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid → Fracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Welkom
• Coordinates
  • Lat. (^o): -28.232288
  • Long. (^o): 26.794365

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080856	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0246235_1005362	F080856	AGGGGG	VEIDLFGKSVNAPKFLEVLEKQFDWFISYTLLLAEKHFEDPDTKKICIAVVFVGDYLWDIHTVRFEEVVYEKERTHRRKLPSPPPAVLEQVLKELRTAYEKAKELPPQVKRRLEEAQER